General Information

  • ID:  hor001894
  • Uniprot ID:  P04093
  • Protein name:  Glucagon
  • Gene name:  gcg
  • Organism:  Ictalurus punctatus (Channel catfish) (Silurus punctatus)
  • Family:  Glucagon family
  • Source:  Animal
  • Expression:  Produced in the A cells of the islets of Langerhans in response to a drop in blood sugar concentration.
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:  Ictalurus (genus), Ictaluridae (family), Siluroidei (suborder), Siluriformes (order), Characiphysae (superorder), Otophysi, Ostariophysi (subcohort), Otomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0007165 signal transduction; GO:0050896 response to stimulus
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  HSEGTFSNDYSKYLETRRAQDFVQWLMNS
  • Length:  29(1-29)
  • Propeptide:  HSEGTFSNDYSKYLETRRAQDFVQWLMNSXXXXXXXXHADGTYTSDVSSYLQEQAAKDFITWLKSGQPKPE
  • Signal peptide:  NA
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Glucagon plays a key role in glucose metabolism and homeostasis.
  • Mechanism:  Increase gluconeogenesis and decrease glycolysis.
  • Cross BBB:  NA
  • Target:  NA
  • Target Unid:  NA
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: NA
  • Half life: NA

Structure

  • Disulfide bond:  NA
  • Structure ID:  NA
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor001894_AF2.pdbhor001894_ESM.pdb

Physical Information

Mass: 401039 Formula: C154H225N43O50S
Absent amino acids: CIP Common amino acids: S
pI: 5.59 Basic residues: 4
Polar residues: 11 Hydrophobic residues: 7
Hydrophobicity: -108.62 Boman Index: -8722
Half-Life: 3.5 hour Half-Life Yeast: 10 min
Half-Life E.Coli: >10 hour Aliphatic Index 40.34
Instability Index: 4536.21 Extinction Coefficient cystines: 8480
Absorbance 280nm: 302.86

Literature

  • PubMed ID:  3030323
  • Title:  Biological activities of catfish glucagon and glucagon-like peptide.
  • PubMed ID:  3838546
  • Title:  Isolation and structures of glucagon and glucagon-like peptide from catfish pancreas.